Lineage for d1rrxa_ (1rrx A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2546826Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2546827Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2546828Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 2546832Protein Green fluorescent protein, GFP [54513] (5 species)
  7. 2546838Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (272 PDB entries)
    Uniprot P42212
  8. 2547082Domain d1rrxa_: 1rrx A: [105085]

Details for d1rrxa_

PDB Entry: 1rrx (more details), 2.1 Å

PDB Description: Crystallographic Evidence for Isomeric Chromophores in 3-Fluorotyrosyl-Green Fluorescent Protein
PDB Compounds: (A:) SIGF1-GFP fusion protein

SCOPe Domain Sequences for d1rrxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rrxa_ d.22.1.1 (A:) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
skgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlv
ttlgygvqcfsrypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtlvn
rielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladh
yqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagi

SCOPe Domain Coordinates for d1rrxa_:

Click to download the PDB-style file with coordinates for d1rrxa_.
(The format of our PDB-style files is described here.)

Timeline for d1rrxa_: