SCOPe 2.06: Domain d1rrvb_: 1rrv B:

Lineage for d1rrvb_ (1rrv B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
   consists of two non-similar domains with 3 layers (a/b/a) each
   domain 1: parallel beta-sheet of 7 strands, order 3214567
   domain 2: parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families)

5. Family c.87.1.5: Gtf glycosyltransferase [64178] (3 proteins)
   Glycosyltransferase family 28

6. Protein TDP-vancosaminyltransferase GftD [110732] (1 species)

7. Species Amycolatopsis orientalis [TaxId:31958] [110733] (1 PDB entry)
   Uniprot Q9AFC7

8. Domain d1rrvb_: 1rrv B: [105084]
   complexed with bgc, gol, k, tyd

Details for d1rrvb_

PDB Entry: 1rrv, 2 Å

PDB Description: x-ray crystal structure of tdp-vancosaminyltransferase gtfd as a complex with tdp and the natural substrate, desvancosaminyl vancomycin.

PDB Compounds: (B:) glycosyltransferase gtfd

SCOPe Domain Sequences for d1rrvb_:

Sequence; same for both SEQRES and ATOM records:

>d1rrvb_ c.87.1.5 (B:) TDP-vancosaminyltransferase GftD {Amycolatopsis orientalis [TaxId: 31958]}
mrvllsvcgtrgdveigvaladrlkalgvqtrmcappaaeerlaevgvphvpvglpqhmm
lqegmpppppeeeqrlaamtvemqfdavpgaaegcaavvavgdlaaatgvrsvaeklglp
ffysvpspvylasphlppaydepttpgvtdirvlweeraarfadrygptlnrrraeiglp
pvedvfgyghgerpllaadpvlaplqpdvdavqtgawllsderplppeleaflaagsppv
higfgsssgrgiadaakvaveairaqgrrvilsrgwtelvlpddrddcfaidevnfqalf
rrvaavihhgsagtehvatragvpqlviprntdqpyfagrvaalgigvahdgptptfesl
saalttvlapetraraeavagmvltdgaaaaadlvlaavg

Timeline for d1rrvb_:

• d1rrvb_ first appeared in SCOP 1.69
  
• d1rrvb_ appears in SCOPe 2.05
  
• d1rrvb_ appears in SCOPe 2.07
  
• d1rrvb_ appears in the current release, SCOPe 2.08