Lineage for d1rrva_ (1rrv A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1007198Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 1007199Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (12 families) (S)
  5. 1007502Family c.87.1.5: Gtf glycosyltransferase [64178] (3 proteins)
    Glycosyltransferase family 28
  6. 1007511Protein TDP-vancosaminyltransferase GftD [110732] (1 species)
  7. 1007512Species Amycolatopsis orientalis [TaxId:31958] [110733] (1 PDB entry)
    Uniprot Q9AFC7
  8. 1007513Domain d1rrva_: 1rrv A: [105083]
    complexed with bgc, gol, k, tyd

Details for d1rrva_

PDB Entry: 1rrv (more details), 2 Å

PDB Description: x-ray crystal structure of tdp-vancosaminyltransferase gtfd as a complex with tdp and the natural substrate, desvancosaminyl vancomycin.
PDB Compounds: (A:) glycosyltransferase gtfd

SCOPe Domain Sequences for d1rrva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rrva_ c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Amycolatopsis orientalis [TaxId: 31958]}
mrvllsvcgtrgdveigvaladrlkalgvqtrmcappaaeerlaevgvphvpvglpqhmm
lqegmpppppeeeqrlaamtvemqfdavpgaaegcaavvavgdlaaatgvrsvaeklglp
ffysvpspvylasphlppaydepttpgvtdirvlweeraarfadrygptlnrrraeiglp
pvedvfgyghgerpllaadpvlaplqpdvdavqtgawllsderplppeleaflaagsppv
higfgsssgrgiadaakvaveairaqgrrvilsrgwtelvlpddrddcfaidevnfqalf
rrvaavihhgsagtehvatragvpqlviprntdqpyfagrvaalgigvahdgptptfesl
saalttvlapetraraeavagmvltdgaaaaadlvlaavgr

SCOPe Domain Coordinates for d1rrva_:

Click to download the PDB-style file with coordinates for d1rrva_.
(The format of our PDB-style files is described here.)

Timeline for d1rrva_: