Lineage for d1rrja3 (1rrj A:201-430)

  1. Root: SCOP 1.69
  2. 517079Class e: Multi-domain proteins (alpha and beta) [56572] (46 folds)
  3. 518456Fold e.15: Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment [56740] (1 superfamily)
    2 domains: alpha+beta and all-beta
  4. 518457Superfamily e.15.1: Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment [56741] (1 family) (S)
  5. 518458Family e.15.1.1: Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment [56742] (1 protein)
  6. 518459Protein Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment [56743] (2 species)
  7. 518462Species Human (Homo sapiens) [TaxId:9606] [56744] (11 PDB entries)
  8. 518465Domain d1rrja3: 1rrj A:201-430 [105080]
    Other proteins in same PDB: d1rrja1, d1rrja2

Details for d1rrja3

PDB Entry: 1rrj (more details), 2.3 Å

PDB Description: structural mechanisms of camptothecin resistance by mutations in human topoisomerase i

SCOP Domain Sequences for d1rrja3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rrja3 e.15.1.1 (A:201-430) Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment {Human (Homo sapiens)}
qkwkwweeerypegikwkflehkgpvfappyeplpenvkfyydgkvmklspkaeevatff
akmldheyttkeifrknffkdwrkemtneekniitnlskcdftqmsqyfkaqtearkqms
keeklkikeenekllkeygfcimdnhkerianfkieppglfrgrgnhpkmgmlkrrimpe
diiincskdakvpspppghkwkevrhdnkvtwlvswteniqgsikyimln

SCOP Domain Coordinates for d1rrja3:

Click to download the PDB-style file with coordinates for d1rrja3.
(The format of our PDB-style files is described here.)

Timeline for d1rrja3: