Lineage for d1rrja2 (1rrj A:431-635,A:713-765)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1441547Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily)
    core: alpha3-beta3-alpha4; one side of beta-sheet is exposed
  4. 1441548Superfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families) (S)
  5. 1441641Family d.163.1.2: Eukaryotic DNA topoisomerase I, catalytic core [56361] (1 protein)
  6. 1441642Protein Eukaryotic DNA topoisomerase I, catalytic core [56362] (2 species)
  7. 1441643Species Human (Homo sapiens) [TaxId:9606] [56363] (15 PDB entries)
    Uniprot P11387 203-765 ! Uniprot P11387 203-767
  8. 1441646Domain d1rrja2: 1rrj A:431-635,A:713-765 [105079]
    Other proteins in same PDB: d1rrja1, d1rrja3
    protein/DNA complex; complexed with ttg; mutant

Details for d1rrja2

PDB Entry: 1rrj (more details), 2.3 Å

PDB Description: structural mechanisms of camptothecin resistance by mutations in human topoisomerase i
PDB Compounds: (A:) DNA topoisomerase I

SCOPe Domain Sequences for d1rrja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rrja2 d.163.1.2 (A:431-635,A:713-765) Eukaryotic DNA topoisomerase I, catalytic core {Human (Homo sapiens) [TaxId: 9606]}
pssrikgekdwqkyetarrlkkcvdkirnqyredwkskemkvrqravalyfidklalrag
nekeegetadtvgccslrvehinlhpeldgqeyvvefdflgkdsiryynkvpvekrvfkn
lqlfmenkqpeddlfdrlntgilnkhlqdlmegltakvfrtynasitlqqqlkeltapde
nipakilsynranravailcnhqraXqialgtsklsyldpritvawckkwgvpiekiynk
tqrekfawaidmadedyef

SCOPe Domain Coordinates for d1rrja2:

Click to download the PDB-style file with coordinates for d1rrja2.
(The format of our PDB-style files is described here.)

Timeline for d1rrja2: