Lineage for d1rrja1 (1rrj A:636-712)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1979820Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1980060Superfamily a.2.8: Eukaryotic DNA topoisomerase I, dispensable insert domain [46596] (1 family) (S)
  5. 1980061Family a.2.8.1: Eukaryotic DNA topoisomerase I, dispensable insert domain [46597] (1 protein)
  6. 1980062Protein Eukaryotic DNA topoisomerase I, dispensable insert domain [46598] (1 species)
  7. 1980063Species Human (Homo sapiens) [TaxId:9606] [46599] (9 PDB entries)
    Uniprot P11387 203-767
  8. 1980065Domain d1rrja1: 1rrj A:636-712 [105078]
    Other proteins in same PDB: d1rrja2, d1rrja3
    protein/DNA complex; complexed with ttg; mutant

Details for d1rrja1

PDB Entry: 1rrj (more details), 2.3 Å

PDB Description: structural mechanisms of camptothecin resistance by mutations in human topoisomerase i
PDB Compounds: (A:) DNA topoisomerase I

SCOPe Domain Sequences for d1rrja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rrja1 a.2.8.1 (A:636-712) Eukaryotic DNA topoisomerase I, dispensable insert domain {Human (Homo sapiens) [TaxId: 9606]}
ppktfeksmmnlqtkidakkeqladarrdlksakadakvmkdaktkkvveskkkavqrle
eqlmklevqatdreenk

SCOPe Domain Coordinates for d1rrja1:

Click to download the PDB-style file with coordinates for d1rrja1.
(The format of our PDB-style files is described here.)

Timeline for d1rrja1: