SCOP 1.69: Domain d1rr8c1: 1rr8 C:431-608,C:708-765

Lineage for d1rr8c1 (1rr8 C:431-608,C:708-765)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily)
   core: alpha3-beta3-alpha4; one side of beta-sheet is exposed

4. Superfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families)

5. Family d.163.1.2: Eukaryotic DNA topoisomerase I, catalytic core [56361] (1 protein)

6. Protein Eukaryotic DNA topoisomerase I, catalytic core [56362] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56363] (11 PDB entries)

8. Domain d1rr8c1: 1rr8 C:431-608,C:708-765 [105076]
   Other proteins in same PDB: d1rr8c2

Details for d1rr8c1

PDB Entry: 1rr8, 2.6 Å

PDB Description: structural mechanisms of camptothecin resistance by mutations in human topoisomerase i

SCOP Domain Sequences for d1rr8c1:

Sequence; same for both SEQRES and ATOM records:

>d1rr8c1 d.163.1.2 (C:431-608,C:708-765) Eukaryotic DNA topoisomerase I, catalytic core {Human (Homo sapiens)}
pssrikgekdwqkyetarrlkkcvdkirnqyredwkskemkvrqravalyfidklalrag
nekeegetadtvgccslrvehinlhpeldgqeyvvefdflgkdsiryynkvpvekrvfkn
lqlfmenkqpeddlfdrlntgilnkhlqdlmegltakvfrtynasitlqqqlkeltapXr
eenkqialgtsklnyldpritvawckkwgvpiekiynktqrekfawaidmadedyef

Timeline for d1rr8c1:

• d1rr8c1 is new in SCOP 1.69
  
• d1rr8c1 appears in SCOP 1.71
  
• d1rr8c1 appears in the current release, SCOPe 2.08