Lineage for d1rr2a2 (1rr2 A:4-306)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 475345Superfamily c.1.10: Aldolase [51569] (6 families) (S)
    Common fold covers whole protein structure
  5. 475803Family c.1.10.5: HMGL-like (Pfam 00682) [89494] (3 proteins)
  6. 475814Protein Transcarboxylase 5S subunit, N-terminal domain [110366] (1 species)
  7. 475815Species Propionibacterium freudenreichii shermanii [TaxId:1752] [110367] (6 PDB entries)
  8. 475818Domain d1rr2a2: 1rr2 A:4-306 [105074]
    Other proteins in same PDB: d1rr2a1

Details for d1rr2a2

PDB Entry: 1rr2 (more details), 2 Å

PDB Description: Propionibacterium shermanii transcarboxylase 5S subunit bound to 2-ketobutyric acid

SCOP Domain Sequences for d1rr2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rr2a2 c.1.10.5 (A:4-306) Transcarboxylase 5S subunit, N-terminal domain {Propionibacterium freudenreichii shermanii}
reievseprevgitelvlrdahqslmatrmamedmvgacadidaagywsvecwggatyds
cirflnedpwerlrtfrklmpnsrlqmllrgqnllgyrhyndevvdrfvdksaengmdvf
rvfdamndprnmahamaavkkagkhaqgticytispvhtvegyvklagqlldmgadsial
kdmaallkpqpaydiikaikdtygqktqinlhchsttgvtevslmkaieagvdvvdtais
smslgpghnptesvaemlegtgyttnldydrlhkirdhfkairpkykkfesktlvdtsif
ksq

SCOP Domain Coordinates for d1rr2a2:

Click to download the PDB-style file with coordinates for d1rr2a2.
(The format of our PDB-style files is described here.)

Timeline for d1rr2a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rr2a1