Lineage for d1rr2a1 (1rr2 A:307-474)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 636335Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 636533Superfamily a.5.7: post-HMGL domain-like [89000] (2 families) (S)
  5. 636545Family a.5.7.2: Conserved carboxylase domain [109725] (1 protein)
    Pfam PF02436
    duplication: contains two domains of this fold, connected with a helical linker
  6. 636546Protein Transcarboxylase 5S subunit, C-terminal domain [109726] (1 species)
  7. 636547Species Propionibacterium freudenreichii shermanii [TaxId:1752] [109727] (6 PDB entries)
  8. 636550Domain d1rr2a1: 1rr2 A:307-474 [105073]
    Other proteins in same PDB: d1rr2a2
    complexed with 2kt, co

Details for d1rr2a1

PDB Entry: 1rr2 (more details), 2 Å

PDB Description: Propionibacterium shermanii transcarboxylase 5S subunit bound to 2-ketobutyric acid
PDB Compounds: (A:) transcarboxylase 5S subunit

SCOP Domain Sequences for d1rr2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rr2a1 a.5.7.2 (A:307-474) Transcarboxylase 5S subunit, C-terminal domain {Propionibacterium freudenreichii shermanii [TaxId: 1752]}
ipggmlsnmesqlraqgaedkmdevmaevprvrkaagfpplvtpssqivgtqavfnvmmg
eykrmtgefadimlgyygaspadrdpkvvklaeeqsgkkpitqrpadllppewekqskea
atlkgfngtdedvltyalfpqvapvffehraegphsvaltdaqlkaea

SCOP Domain Coordinates for d1rr2a1:

Click to download the PDB-style file with coordinates for d1rr2a1.
(The format of our PDB-style files is described here.)

Timeline for d1rr2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rr2a2