SCOPe 2.08: Domain d1rr2a1: 1rr2 A:307-474

Lineage for d1rr2a1 (1rr2 A:307-474)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
   3 helices; bundle, right-handed twist

4. Superfamily a.5.7: post-HMGL domain-like [89000] (3 families)

5. Family a.5.7.2: Conserved carboxylase domain [109725] (1 protein)
   Pfam PF02436
   duplication: contains two domains of this fold, connected with a helical linker

6. Protein Transcarboxylase 5S subunit, C-terminal domain [109726] (1 species)

7. Species Propionibacterium freudenreichii shermanii [TaxId:1752] [109727] (6 PDB entries)
   Uniprot Q70AC7 3-474; d1: 307-367; d2: 416-459

8. Domain d1rr2a1: 1rr2 A:307-474 [105073]
   Other proteins in same PDB: d1rr2a2
   complexed with 2kt, co

Details for d1rr2a1

PDB Entry: 1rr2, 2 Å

PDB Description: Propionibacterium shermanii transcarboxylase 5S subunit bound to 2-ketobutyric acid

PDB Compounds: (A:) transcarboxylase 5S subunit

SCOPe Domain Sequences for d1rr2a1:

Sequence; same for both SEQRES and ATOM records:

>d1rr2a1 a.5.7.2 (A:307-474) Transcarboxylase 5S subunit, C-terminal domain {Propionibacterium freudenreichii shermanii [TaxId: 1752]}
ipggmlsnmesqlraqgaedkmdevmaevprvrkaagfpplvtpssqivgtqavfnvmmg
eykrmtgefadimlgyygaspadrdpkvvklaeeqsgkkpitqrpadllppewekqskea
atlkgfngtdedvltyalfpqvapvffehraegphsvaltdaqlkaea

Timeline for d1rr2a1:

• d1rr2a1 first appeared in SCOP 1.69
  
• d1rr2a1 appears in SCOPe 2.07