Lineage for d1rqxb_ (1rqx B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2139769Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2139770Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2139771Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 protein domains)
  6. 2139772Protein 1-aminocyclopropane-1-carboxylate deaminase [53694] (3 species)
  7. 2139773Species Pseudomonas sp., strain ACP [TaxId:306] [110722] (6 PDB entries)
    Uniprot Q00740
  8. 2139795Domain d1rqxb_: 1rqx B: [105070]
    complexed with mlp, plp

Details for d1rqxb_

PDB Entry: 1rqx (more details), 2.5 Å

PDB Description: Crystal structure of ACC Deaminase complexed with Inhibitor
PDB Compounds: (B:) 1-aminocyclopropane-1-carboxylate deaminase

SCOPe Domain Sequences for d1rqxb_:

Sequence, based on SEQRES records: (download)

>d1rqxb_ c.79.1.1 (B:) 1-aminocyclopropane-1-carboxylate deaminase {Pseudomonas sp., strain ACP [TaxId: 306]}
mnlqrfprypltfgptpiqplarlskhlggkvhlyakredcnsglafggnktrkleylip
ealaqgcdtlvsiggiqsnqtrqvaavaahlgmkcvlvqenwvnysdavydrvgniqmsr
ilgadvrlvpdgfdigfrrswedalesvraaggkpyaipagcsdhplgglgfvgfaeevr
aqeaelgfkfdyvvvcsvtgstqagmvvgfaadgradrvigvdasakpaqtreqitriar
qtaekvglerdimradvvlderfagpeyglpnegtleairlcartegmltdpvyegksmh
gmiemvrngefpegsrvlyahlggvpalngysfifrdg

Sequence, based on observed residues (ATOM records): (download)

>d1rqxb_ c.79.1.1 (B:) 1-aminocyclopropane-1-carboxylate deaminase {Pseudomonas sp., strain ACP [TaxId: 306]}
mnlqrfprypltfgptpiqplarlskhlggkvhlyakredcnsglafggnktrkleylip
ealaqgcdtlvsiggiqsnqtrqvaavaahlgmkcvlvqenwvnysdavydrvgniqmsr
ilgadvrlvswedalesvraaggkpyaipagcsdhplgglgfvgfaeevraqeaelgfkf
dyvvvcsvtgstqagmvvgfaadgradrvigvdasakpaqtreqitriarqtaekvgler
dimradvvlderfagpeyglpnegtleairlcartegmltdpvyegksmhgmiemvrnge
fpegsrvlyahlggvpalngysfifrdg

SCOPe Domain Coordinates for d1rqxb_:

Click to download the PDB-style file with coordinates for d1rqxb_.
(The format of our PDB-style files is described here.)

Timeline for d1rqxb_: