Lineage for d1rqxa_ (1rqx A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 493418Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 493419Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family) (S)
  5. 493420Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (7 proteins)
  6. 493421Protein 1-aminocyclopropane-1-carboxylate deaminase [53694] (3 species)
  7. 493450Species Pseudomonas sp., strain ACP [TaxId:306] [110722] (1 PDB entry)
  8. 493451Domain d1rqxa_: 1rqx A: [105069]

Details for d1rqxa_

PDB Entry: 1rqx (more details), 2.5 Å

PDB Description: Crystal structure of ACC Deaminase complexed with Inhibitor

SCOP Domain Sequences for d1rqxa_:

Sequence, based on SEQRES records: (download)

>d1rqxa_ c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate deaminase {Pseudomonas sp., strain ACP}
mnlqrfprypltfgptpiqplarlskhlggkvhlyakredcnsglafggnktrkleylip
ealaqgcdtlvsiggiqsnqtrqvaavaahlgmkcvlvqenwvnysdavydrvgniqmsr
ilgadvrlvpdgfdigfrrswedalesvraaggkpyaipagcsdhplgglgfvgfaeevr
aqeaelgfkfdyvvvcsvtgstqagmvvgfaadgradrvigvdasakpaqtreqitriar
qtaekvglerdimradvvlderfagpeyglpnegtleairlcartegmltdpvyegksmh
gmiemvrngefpegsrvlyahlggvpalngysfifrdg

Sequence, based on observed residues (ATOM records): (download)

>d1rqxa_ c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate deaminase {Pseudomonas sp., strain ACP}
mnlqrfprypltfgptpiqplarlskhlggkvhlyakredcnsglafggnktrkleylip
ealaqgcdtlvsiggiqsnqtrqvaavaahlgmkcvlvqenwvnysdavydrvgniqmsr
ilgadvrlvpdrswedalesvraaggkpyaipagcsdhplgglgfvgfaeevraqeaelg
fkfdyvvvcsvtgstqagmvvgfaadgradrvigvdasakpaqtreqitriarqtaekvg
lerdimradvvlderfagpeyglpnegtleairlcartegmltdpvyegksmhgmiemvr
ngefpegsrvlyahlggvpalngysfifrdg

SCOP Domain Coordinates for d1rqxa_:

Click to download the PDB-style file with coordinates for d1rqxa_.
(The format of our PDB-style files is described here.)

Timeline for d1rqxa_: