SCOPe 2.07: Domain d1rqma_: 1rqm A:

Lineage for d1rqma_ (1rqm A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.1: Thioltransferase [52834] (16 proteins)

6. Protein Thioredoxin [52835] (16 species)

7. Species Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId:405212] [52839] (4 PDB entries)
   Uniprot P80579

8. Domain d1rqma_: 1rqm A: [105068]
   mutant

Details for d1rqma_

PDB Entry: 1rqm

PDB Description: solution structure of the k18g/r82e alicyclobacillus acidocaldarius thioredoxin mutant

PDB Compounds: (A:) thioredoxin

SCOPe Domain Sequences for d1rqma_:

Sequence; same for both SEQRES and ATOM records:

>d1rqma_ c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId: 405212]}
atmtltdanfqqaiqgdgpvlvdfwaawcgpcrmmapvleefaeahadkvtvaklnvden
pettsqfgimsiptlilfkggepvkqligyqpkeqleaqladvlq

Timeline for d1rqma_:

• d1rqma_ first appeared in SCOP 1.69
  
• d1rqma_ appears in SCOPe 2.06
  
• d1rqma_ appears in the current release, SCOPe 2.08