Lineage for d1rqma_ (1rqm A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 486470Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 486471Superfamily c.47.1: Thioredoxin-like [52833] (15 families) (S)
  5. 486472Family c.47.1.1: Thioltransferase [52834] (11 proteins)
  6. 486522Protein Thioredoxin [52835] (10 species)
  7. 486523Species Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId:405212] [52839] (4 PDB entries)
  8. 486537Domain d1rqma_: 1rqm A: [105068]

Details for d1rqma_

PDB Entry: 1rqm (more details)

PDB Description: solution structure of the k18g/r82e alicyclobacillus acidocaldarius thioredoxin mutant

SCOP Domain Sequences for d1rqma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rqma_ c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius}
atmtltdanfqqaiqgdgpvlvdfwaawcgpcrmmapvleefaeahadkvtvaklnvden
pettsqfgimsiptlilfkggepvkqligyqpkeqleaqladvlq

SCOP Domain Coordinates for d1rqma_:

Click to download the PDB-style file with coordinates for d1rqma_.
(The format of our PDB-style files is described here.)

Timeline for d1rqma_: