SCOP 1.73: Domain d1rqga3: 1rqg A:139-173

Lineage for d1rqga3 (1rqg A:139-173)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.41: Rubredoxin-like [57769] (16 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.1: Methionyl-tRNA synthetase (MetRS), Zn-domain [57770] (1 family)

5. Family g.41.1.1: Methionyl-tRNA synthetase (MetRS), Zn-domain [57771] (1 protein)
   in the Pyrococcus abyssi MetRS structure there is a tandem repeat of two such domains swapped with their zinc-binding 'knuckles', this duplicated finger occupies a larger region (124-183) than defined below; there is a structurally equivalent region in the E. coli enzyme lacking the second zinc-binding site

6. Protein Methionyl-tRNA synthetase (MetRS), Zn-domain [57772] (2 species)

7. Species Pyrococcus abyssi [TaxId:29292] [111451] (1 PDB entry)

8. Domain d1rqga3: 1rqg A:139-173 [105065]
   Other proteins in same PDB: d1rqga1, d1rqga2
   complexed with zn

Details for d1rqga3

PDB Entry: 1rqg, 2.9 Å

PDB Description: Methionyl-tRNA synthetase from Pyrococcus abyssi

PDB Compounds: (A:) Methionyl-tRNA synthetase

SCOP Domain Sequences for d1rqga3:

Sequence; same for both SEQRES and ATOM records:

>d1rqga3 g.41.1.1 (A:139-173) Methionyl-tRNA synthetase (MetRS), Zn-domain {Pyrococcus abyssi [TaxId: 29292]}
vigtcpycgaedqkgdqcevcgrpltpeilinprc

Timeline for d1rqga3:

• d1rqga3 first appeared in SCOP 1.69
  
• d1rqga3 appears in SCOP 1.71
  
• d1rqga3 appears in SCOP 1.75
  
• d1rqga3 appears in the current release, SCOPe 2.08