Lineage for d1rqga2 (1rqg A:1-138,A:174-396)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2468308Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2468309Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2468310Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 2468389Protein Methionyl-tRNA synthetase (MetRS) [52384] (3 species)
  7. 2468400Species Pyrococcus abyssi [TaxId:29292] [110490] (1 PDB entry)
    Uniprot Q9V011 1-606 # C-domain 616-722 is solved separately: 1MKH
  8. 2468401Domain d1rqga2: 1rqg A:1-138,A:174-396 [105064]
    Other proteins in same PDB: d1rqga1, d1rqga3
    complexed with zn

Details for d1rqga2

PDB Entry: 1rqg (more details), 2.9 Å

PDB Description: Methionyl-tRNA synthetase from Pyrococcus abyssi
PDB Compounds: (A:) Methionyl-tRNA synthetase

SCOPe Domain Sequences for d1rqga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rqga2 c.26.1.1 (A:1-138,A:174-396) Methionyl-tRNA synthetase (MetRS) {Pyrococcus abyssi [TaxId: 29292]}
mvrymvtsalpyangpihaghlagaylpadifvrylrlkgedvvficgtdehgtpisfra
lkegrspreivdefheqikitfqrakisfdffgrtelpihyklsqefflkayenghlvkk
vtkqaycehdkmflpdrfXaicgrpisfrdsahyyikmqdfaerlkrwiekqpwkpnvkn
mvlswieegleeraitrdlnwgipvpldeedmkgkvlyvwfeapigyisitiehfkrigk
pnewkkywlnidgqtrvihfigkdnipfhaifwpaflmaygkykdeeveaewnlpydipa
neyltlegkkfstsrnwaiwvhefldvfpadylryylttimpetrdsdfsfsdfkvrine
el

SCOPe Domain Coordinates for d1rqga2:

Click to download the PDB-style file with coordinates for d1rqga2.
(The format of our PDB-style files is described here.)

Timeline for d1rqga2: