Lineage for d1rqga1 (1rqg A:397-606)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319167Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
    core: 4 helices; bundle; one loop crosses over one side of the bundle
  4. 2319168Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) (S)
  5. 2319169Family a.27.1.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47324] (6 proteins)
  6. 2319198Protein Methionyl-tRNA synthetase (MetRS) [47325] (3 species)
    this domain follows the Rossmann-fold catalytic domain of class I aaRS
  7. 2319209Species Pyrococcus abyssi [TaxId:29292] [109792] (1 PDB entry)
    Uniprot Q9V011 1-606 # C-domain 616-722 is solved separately: 1MKH
  8. 2319210Domain d1rqga1: 1rqg A:397-606 [105063]
    Other proteins in same PDB: d1rqga2, d1rqga3
    complexed with zn

Details for d1rqga1

PDB Entry: 1rqg (more details), 2.9 Å

PDB Description: Methionyl-tRNA synthetase from Pyrococcus abyssi
PDB Compounds: (A:) Methionyl-tRNA synthetase

SCOPe Domain Sequences for d1rqga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rqga1 a.27.1.1 (A:397-606) Methionyl-tRNA synthetase (MetRS) {Pyrococcus abyssi [TaxId: 29292]}
vnnlgnfvhraltfvnryfdgvvpergeldeldrealeeiekafkevgelimnyrfkdal
krvmslasfgnryfdhkqpwktakedkvrtgttvnislqivkalgillepflpdasekiw
hllnldevkrwefrelpaghkvrkpeilfkkvtddqiiyfilnymakgnpegarilldky
ykredvirvakekfgdeaevvlrrvykdik

SCOPe Domain Coordinates for d1rqga1:

Click to download the PDB-style file with coordinates for d1rqga1.
(The format of our PDB-style files is described here.)

Timeline for d1rqga1: