SCOPe 2.06: Domain d1rqga1: 1rqg A:397-606

Lineage for d1rqga1 (1rqg A:397-606)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
   core: 4 helices; bundle; one loop crosses over one side of the bundle

4. Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families)

5. Family a.27.1.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47324] (6 proteins)

6. Protein Methionyl-tRNA synthetase (MetRS) [47325] (3 species)
   this domain follows the Rossmann-fold catalytic domain of class I aaRS

7. Species Pyrococcus abyssi [TaxId:29292] [109792] (1 PDB entry)
   Uniprot Q9V011 1-606 # C-domain 616-722 is solved separately: 1MKH

8. Domain d1rqga1: 1rqg A:397-606 [105063]
   Other proteins in same PDB: d1rqga2, d1rqga3
   complexed with zn

Details for d1rqga1

PDB Entry: 1rqg, 2.9 Å

PDB Description: Methionyl-tRNA synthetase from Pyrococcus abyssi

PDB Compounds: (A:) Methionyl-tRNA synthetase

SCOPe Domain Sequences for d1rqga1:

Sequence; same for both SEQRES and ATOM records:

>d1rqga1 a.27.1.1 (A:397-606) Methionyl-tRNA synthetase (MetRS) {Pyrococcus abyssi [TaxId: 29292]}
vnnlgnfvhraltfvnryfdgvvpergeldeldrealeeiekafkevgelimnyrfkdal
krvmslasfgnryfdhkqpwktakedkvrtgttvnislqivkalgillepflpdasekiw
hllnldevkrwefrelpaghkvrkpeilfkkvtddqiiyfilnymakgnpegarilldky
ykredvirvakekfgdeaevvlrrvykdik

Timeline for d1rqga1:

• d1rqga1 first appeared in SCOP 1.69
  
• d1rqga1 appears in SCOPe 2.05
  
• d1rqga1 appears in SCOPe 2.07
  
• d1rqga1 appears in the current release, SCOPe 2.08