Lineage for d1rqea2 (1rqe A:4-306)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 572455Superfamily c.1.10: Aldolase [51569] (6 families) (S)
    Common fold covers whole protein structure
  5. 572940Family c.1.10.5: HMGL-like [89494] (3 proteins)
    Pfam 00682
  6. 572951Protein Transcarboxylase 5S subunit, N-terminal domain [110366] (1 species)
  7. 572952Species Propionibacterium freudenreichii shermanii [TaxId:1752] [110367] (6 PDB entries)
  8. 572956Domain d1rqea2: 1rqe A:4-306 [105062]
    Other proteins in same PDB: d1rqea1
    complexed with co, oaa

Details for d1rqea2

PDB Entry: 1rqe (more details), 2.5 Å

PDB Description: Propionibacterium shermanii transcarboxylase 5S subunit bound to oxaloacetate

SCOP Domain Sequences for d1rqea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rqea2 c.1.10.5 (A:4-306) Transcarboxylase 5S subunit, N-terminal domain {Propionibacterium freudenreichii shermanii}
reievseprevgitelvlrdahqslmatrmamedmvgacadidaagywsvecwggatyds
cirflnedpwerlrtfrklmpnsrlqmllrgqnllgyrhyndevvdrfvdksaengmdvf
rvfdamndprnmahamaavkkagkhaqgticytispvhtvegyvklagqlldmgadsial
kdmaallkpqpaydiikaikdtygqktqinlhchsttgvtevslmkaieagvdvvdtais
smslgpghnptesvaemlegtgyttnldydrlhkirdhfkairpkykkfesktlvdtsif
ksq

SCOP Domain Coordinates for d1rqea2:

Click to download the PDB-style file with coordinates for d1rqea2.
(The format of our PDB-style files is described here.)

Timeline for d1rqea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rqea1