Lineage for d1rqea1 (1rqe A:307-474)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2309372Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 2309656Superfamily a.5.7: post-HMGL domain-like [89000] (3 families) (S)
  5. 2309668Family a.5.7.2: Conserved carboxylase domain [109725] (1 protein)
    Pfam PF02436
    duplication: contains two domains of this fold, connected with a helical linker
  6. 2309669Protein Transcarboxylase 5S subunit, C-terminal domain [109726] (1 species)
  7. 2309670Species Propionibacterium freudenreichii shermanii [TaxId:1752] [109727] (6 PDB entries)
    Uniprot Q70AC7 3-474; d1: 307-367; d2: 416-459
  8. 2309674Domain d1rqea1: 1rqe A:307-474 [105061]
    Other proteins in same PDB: d1rqea2
    complexed with co, oaa

Details for d1rqea1

PDB Entry: 1rqe (more details), 2.5 Å

PDB Description: Propionibacterium shermanii transcarboxylase 5S subunit bound to oxaloacetate
PDB Compounds: (A:) transcarboxylase 5S subunit

SCOPe Domain Sequences for d1rqea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rqea1 a.5.7.2 (A:307-474) Transcarboxylase 5S subunit, C-terminal domain {Propionibacterium freudenreichii shermanii [TaxId: 1752]}
ipggmlsnmesqlraqgaedkmdevmaevprvrkaagfpplvtpssqivgtqavfnvmmg
eykrmtgefadimlgyygaspadrdpkvvklaeeqsgkkpitqrpadllppewekqskea
atlkgfngtdedvltyalfpqvapvffehraegphsvaltdaqlkaea

SCOPe Domain Coordinates for d1rqea1:

Click to download the PDB-style file with coordinates for d1rqea1.
(The format of our PDB-style files is described here.)

Timeline for d1rqea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rqea2