Lineage for d1rqda_ (1rqd A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1843167Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 1843168Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 1843169Family c.31.1.1: Deoxyhypusine synthase, DHS [52468] (1 protein)
    automatically mapped to Pfam PF01916
  6. 1843170Protein Deoxyhypusine synthase, DHS [52469] (1 species)
  7. 1843171Species Human (Homo sapiens) [TaxId:9606] [52470] (4 PDB entries)
    Uniprot P49366
  8. 1843176Domain d1rqda_: 1rqd A: [105059]
    complexed with gc7, nad

Details for d1rqda_

PDB Entry: 1rqd (more details), 3 Å

PDB Description: deoxyhypusine synthase holoenzyme in its low ionic strength, high pH crystal form with the inhibitor GC7 bound in the active site
PDB Compounds: (A:) deoxyhypusine synthase

SCOPe Domain Sequences for d1rqda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rqda_ c.31.1.1 (A:) Deoxyhypusine synthase, DHS {Human (Homo sapiens) [TaxId: 9606]}
stqvrgydfnrgvnyralleafgttgfqatnfgravqqvnamiekkleplsqdedqhadl
tqsrrpltsctiflgytsnlissgiretirylvqhnmvdvlvttaggveedlikclapty
lgefslrgkelrenginrignllvpnenyckfedwlmpildqmvmeqntegvkwtpskmi
arlgkeinnpesvyywaqknhipvfspaltdgslgdmiffhsyknpglvldivedlrlin
tqaifakctgmiilgggvvkhhiananlmrngadyavyintaqefdgsdsgarpdeavsw
gkirvdaqpvkvyadaslvfpllvaetfaqkmdafmh

SCOPe Domain Coordinates for d1rqda_:

Click to download the PDB-style file with coordinates for d1rqda_.
(The format of our PDB-style files is described here.)

Timeline for d1rqda_: