Lineage for d1rqda_ (1rqd A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 483121Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 483122Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (5 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 483123Family c.31.1.1: Deoxyhypusine synthase, DHS [52468] (1 protein)
  6. 483124Protein Deoxyhypusine synthase, DHS [52469] (1 species)
  7. 483125Species Human (Homo sapiens) [TaxId:9606] [52470] (4 PDB entries)
  8. 483130Domain d1rqda_: 1rqd A: [105059]

Details for d1rqda_

PDB Entry: 1rqd (more details), 3 Å

PDB Description: deoxyhypusine synthase holoenzyme in its low ionic strength, high pH crystal form with the inhibitor GC7 bound in the active site

SCOP Domain Sequences for d1rqda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rqda_ c.31.1.1 (A:) Deoxyhypusine synthase, DHS {Human (Homo sapiens)}
stqvrgydfnrgvnyralleafgttgfqatnfgravqqvnamiekkleplsqdedqhadl
tqsrrpltsctiflgytsnlissgiretirylvqhnmvdvlvttaggveedlikclapty
lgefslrgkelrenginrignllvpnenyckfedwlmpildqmvmeqntegvkwtpskmi
arlgkeinnpesvyywaqknhipvfspaltdgslgdmiffhsyknpglvldivedlrlin
tqaifakctgmiilgggvvkhhiananlmrngadyavyintaqefdgsdsgarpdeavsw
gkirvdaqpvkvyadaslvfpllvaetfaqkmdafmh

SCOP Domain Coordinates for d1rqda_:

Click to download the PDB-style file with coordinates for d1rqda_.
(The format of our PDB-style files is described here.)

Timeline for d1rqda_: