Lineage for d1rqba2 (1rqb A:4-306)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2835865Family c.1.10.5: HMGL-like [89494] (3 proteins)
    Pfam PF00682
  6. 2835876Protein Transcarboxylase 5S subunit, N-terminal domain [110366] (1 species)
  7. 2835877Species Propionibacterium freudenreichii shermanii [TaxId:1752] [110367] (6 PDB entries)
    Uniprot Q70AC7 3-474
  8. 2835878Domain d1rqba2: 1rqb A:4-306 [105058]
    Other proteins in same PDB: d1rqba1
    complexed with co

Details for d1rqba2

PDB Entry: 1rqb (more details), 1.9 Å

PDB Description: Propionibacterium shermanii transcarboxylase 5S subunit
PDB Compounds: (A:) transcarboxylase 5S subunit

SCOPe Domain Sequences for d1rqba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rqba2 c.1.10.5 (A:4-306) Transcarboxylase 5S subunit, N-terminal domain {Propionibacterium freudenreichii shermanii [TaxId: 1752]}
reievseprevgitelvlrdahqslmatrmamedmvgacadidaagywsvecwggatyds
cirflnedpwerlrtfrklmpnsrlqmllrgqnllgyrhyndevvdrfvdksaengmdvf
rvfdamndprnmahamaavkkagkhaqgticytispvhtvegyvklagqlldmgadsial
kdmaallkpqpaydiikaikdtygqktqinlhchsttgvtevslmkaieagvdvvdtais
smslgpghnptesvaemlegtgyttnldydrlhkirdhfkairpkykkfesktlvdtsif
ksq

SCOPe Domain Coordinates for d1rqba2:

Click to download the PDB-style file with coordinates for d1rqba2.
(The format of our PDB-style files is described here.)

Timeline for d1rqba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rqba1