Lineage for d1rqba1 (1rqb A:307-474)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 907887Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 908101Superfamily a.5.7: post-HMGL domain-like [89000] (2 families) (S)
  5. 908113Family a.5.7.2: Conserved carboxylase domain [109725] (1 protein)
    Pfam PF02436
    duplication: contains two domains of this fold, connected with a helical linker
  6. 908114Protein Transcarboxylase 5S subunit, C-terminal domain [109726] (1 species)
  7. 908115Species Propionibacterium freudenreichii shermanii [TaxId:1752] [109727] (6 PDB entries)
    Uniprot Q70AC7 3-474; d1: 307-367; d2: 416-459
  8. 908116Domain d1rqba1: 1rqb A:307-474 [105057]
    Other proteins in same PDB: d1rqba2
    complexed with co

Details for d1rqba1

PDB Entry: 1rqb (more details), 1.9 Å

PDB Description: Propionibacterium shermanii transcarboxylase 5S subunit
PDB Compounds: (A:) transcarboxylase 5S subunit

SCOPe Domain Sequences for d1rqba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rqba1 a.5.7.2 (A:307-474) Transcarboxylase 5S subunit, C-terminal domain {Propionibacterium freudenreichii shermanii [TaxId: 1752]}
ipggmlsnmesqlraqgaedkmdevmaevprvrkaagfpplvtpssqivgtqavfnvmmg
eykrmtgefadimlgyygaspadrdpkvvklaeeqsgkkpitqrpadllppewekqskea
atlkgfngtdedvltyalfpqvapvffehraegphsvaltdaqlkaea

SCOPe Domain Coordinates for d1rqba1:

Click to download the PDB-style file with coordinates for d1rqba1.
(The format of our PDB-style files is described here.)

Timeline for d1rqba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rqba2