Lineage for d1rq8a_ (1rq8 A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 505944Fold d.68: IF3-like [55199] (7 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 506028Superfamily d.68.4: YhbY-like [75471] (1 family) (S)
  5. 506029Family d.68.4.1: YhbY-like [75472] (3 proteins)
    Pfam 1985
  6. 506030Protein Hypothetical protein SAV1595 [111025] (1 species)
  7. 506031Species Staphylococcus aureus, (strain Mu50 / ATCC 700699) [TaxId:1280] [111026] (1 PDB entry)
  8. 506032Domain d1rq8a_: 1rq8 A: [105056]
    Structural genomics target

Details for d1rq8a_

PDB Entry: 1rq8 (more details)

PDB Description: Solution structure of the hypothetical protein SAV1595 from Staphylococcus aureus, a putative RNA binding protein

SCOP Domain Sequences for d1rq8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rq8a_ d.68.4.1 (A:) Hypothetical protein SAV1595 {Staphylococcus aureus, (strain Mu50 / ATCC 700699)}
mltgkqkrylrslahnidpifqigkgginenmikqiddtlenrelikvhvlqnnfddkke
laetlseatrselvqvigsmiviyreskenkeielp

SCOP Domain Coordinates for d1rq8a_:

Click to download the PDB-style file with coordinates for d1rq8a_.
(The format of our PDB-style files is described here.)

Timeline for d1rq8a_: