![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.68: IF3-like [55199] (8 superfamilies) beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest |
![]() | Superfamily d.68.4: YhbY-like [75471] (1 family) ![]() automatically mapped to Pfam PF01985 |
![]() | Family d.68.4.1: YhbY-like [75472] (3 proteins) Pfam PF01985 |
![]() | Protein Hypothetical protein SAV1595 [111025] (1 species) |
![]() | Species Staphylococcus aureus, (strain Mu50 / ATCC 700699) [TaxId:1280] [111026] (1 PDB entry) Uniprot Q99TQ4 |
![]() | Domain d1rq8a_: 1rq8 A: [105056] Structural genomics target |
PDB Entry: 1rq8 (more details)
SCOPe Domain Sequences for d1rq8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rq8a_ d.68.4.1 (A:) Hypothetical protein SAV1595 {Staphylococcus aureus, (strain Mu50 / ATCC 700699) [TaxId: 1280]} mltgkqkrylrslahnidpifqigkgginenmikqiddtlenrelikvhvlqnnfddkke laetlseatrselvqvigsmiviyreskenkeielp
Timeline for d1rq8a_: