Lineage for d1rq8a_ (1rq8 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2957073Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 2957392Superfamily d.68.4: YhbY-like [75471] (1 family) (S)
    automatically mapped to Pfam PF01985
  5. 2957393Family d.68.4.1: YhbY-like [75472] (3 proteins)
    Pfam PF01985
  6. 2957394Protein Hypothetical protein SAV1595 [111025] (1 species)
  7. 2957395Species Staphylococcus aureus, (strain Mu50 / ATCC 700699) [TaxId:1280] [111026] (1 PDB entry)
    Uniprot Q99TQ4
  8. 2957396Domain d1rq8a_: 1rq8 A: [105056]
    Structural genomics target

Details for d1rq8a_

PDB Entry: 1rq8 (more details)

PDB Description: solution structure of the hypothetical protein sav1595 from staphylococcus aureus, a putative rna binding protein
PDB Compounds: (A:) conserved hypothetical protein

SCOPe Domain Sequences for d1rq8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rq8a_ d.68.4.1 (A:) Hypothetical protein SAV1595 {Staphylococcus aureus, (strain Mu50 / ATCC 700699) [TaxId: 1280]}
mltgkqkrylrslahnidpifqigkgginenmikqiddtlenrelikvhvlqnnfddkke
laetlseatrselvqvigsmiviyreskenkeielp

SCOPe Domain Coordinates for d1rq8a_:

Click to download the PDB-style file with coordinates for d1rq8a_.
(The format of our PDB-style files is described here.)

Timeline for d1rq8a_: