| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (1 family) ![]() |
| Family d.79.2.1: Tubulin, C-terminal domain [55308] (3 proteins) |
| Protein Cell-division protein FtsZ [55309] (4 species) |
| Species Mycobacterium tuberculosis [TaxId:1773] [111032] (5 PDB entries) Uniprot O08378 |
| Domain d1rq7b2: 1rq7 B:206-312 [105055] Other proteins in same PDB: d1rq7a1, d1rq7b1 complexed with gdp |
PDB Entry: 1rq7 (more details), 2.6 Å
SCOPe Domain Sequences for d1rq7b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rq7b2 d.79.2.1 (B:206-312) Cell-division protein FtsZ {Mycobacterium tuberculosis [TaxId: 1773]}
vdfadvkgimsgagtalmgigsargegrslkaaeiainsplleasmegaqgvlmsiaggs
dlglfeineaaslvqdaahpdaniifgtviddslgdevrvtviaagf
Timeline for d1rq7b2: