Lineage for d1rq7b2 (1rq7 B:206-312)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 506461Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 506560Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (1 family) (S)
  5. 506561Family d.79.2.1: Tubulin, C-terminal domain [55308] (3 proteins)
  6. 506562Protein Cell-division protein FtsZ [55309] (3 species)
  7. 506565Species Mycobacterium tuberculosis [TaxId:1773] [111032] (3 PDB entries)
  8. 506571Domain d1rq7b2: 1rq7 B:206-312 [105055]
    Other proteins in same PDB: d1rq7a1, d1rq7b1

Details for d1rq7b2

PDB Entry: 1rq7 (more details), 2.6 Å

PDB Description: mycobacterium tuberculosis ftsz in complex with gdp

SCOP Domain Sequences for d1rq7b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rq7b2 d.79.2.1 (B:206-312) Cell-division protein FtsZ {Mycobacterium tuberculosis}
vdfadvkgimsgagtalmgigsargegrslkaaeiainsplleasmegaqgvlmsiaggs
dlglfeineaaslvqdaahpdaniifgtviddslgdevrvtviaagf

SCOP Domain Coordinates for d1rq7b2:

Click to download the PDB-style file with coordinates for d1rq7b2.
(The format of our PDB-style files is described here.)

Timeline for d1rq7b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rq7b1