Lineage for d1rq7b1 (1rq7 B:8-205)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. Protein Cell-division protein FtsZ [52492] (9 species)
  7. Species Mycobacterium tuberculosis [TaxId:1773] [110501] (6 PDB entries)
    Uniprot O08378
  8. Domain d1rq7b1: 1rq7 B:8-205 [105054]
    Other proteins in same PDB: d1rq7a2, d1rq7b2
    complexed with gdp

Details for d1rq7b1

PDB Entry: 1rq7 (more details), 2.6 Å

PDB Description: mycobacterium tuberculosis ftsz in complex with gdp
PDB Compounds: (B:) cell division protein ftsz

SCOPe Domain Sequences for d1rq7b1:

Sequence, based on SEQRES records: (download)

>d1rq7b1 c.32.1.1 (B:8-205) Cell-division protein FtsZ {Mycobacterium tuberculosis [TaxId: 1773]}
lavikvvgiggggvnavnrmieqglkgvefiaintdaqallmsdadvkldvgrdstrglg
agadpevgrkaaedakdeieellrgadmvfvtagegggtgtggapvvasiarklgaltvg
vvtrpfsfegkrrsnqaengiaalrescdtlivipndrllqmgdaavslmdafrsadevl
lngvqgitdlittpglin

Sequence, based on observed residues (ATOM records): (download)

>d1rq7b1 c.32.1.1 (B:8-205) Cell-division protein FtsZ {Mycobacterium tuberculosis [TaxId: 1773]}
lavikvvgiggggvnavnrmieqglkgvefiaintdaqallmsdadvkldvgadpevgrk
aaedakdeieellrgadmvfvtagegggtgtggapvvasiarklgaltvgvvtrpfsfeg
krrsnqaengiaalrescdtlivipndrllqmgvslmdafrsadevllngvqgitdlitt
pglin

SCOPe Domain Coordinates for d1rq7b1 are not available.

Timeline for d1rq7b1:

Domains from same chain:
(mouse over for more information)
d1rq7b2
Domains from other chains:
(mouse over for more information)
d1rq7a1, d1rq7a2