Lineage for d1rq7a2 (1rq7 A:206-312)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1209532Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1209762Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (1 family) (S)
  5. 1209763Family d.79.2.1: Tubulin, C-terminal domain [55308] (3 proteins)
  6. 1209764Protein Cell-division protein FtsZ [55309] (4 species)
  7. 1209784Species Mycobacterium tuberculosis [TaxId:1773] [111032] (5 PDB entries)
    Uniprot O08378
  8. 1209793Domain d1rq7a2: 1rq7 A:206-312 [105053]
    Other proteins in same PDB: d1rq7a1, d1rq7b1
    complexed with gdp

Details for d1rq7a2

PDB Entry: 1rq7 (more details), 2.6 Å

PDB Description: mycobacterium tuberculosis ftsz in complex with gdp
PDB Compounds: (A:) cell division protein ftsz

SCOPe Domain Sequences for d1rq7a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rq7a2 d.79.2.1 (A:206-312) Cell-division protein FtsZ {Mycobacterium tuberculosis [TaxId: 1773]}
vdfadvkgimsgagtalmgigsargegrslkaaeiainsplleasmegaqgvlmsiaggs
dlglfeineaaslvqdaahpdaniifgtviddslgdevrvtviaagf

SCOPe Domain Coordinates for d1rq7a2:

Click to download the PDB-style file with coordinates for d1rq7a2.
(The format of our PDB-style files is described here.)

Timeline for d1rq7a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rq7a1