SCOPe 2.08: Domain d1rq7a1: 1rq7 A:8-205

Lineage for d1rq7a1 (1rq7 A:8-205)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein Cell-division protein FtsZ [52492] (9 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [110501] (6 PDB entries)
   Uniprot O08378

8. Domain d1rq7a1: 1rq7 A:8-205 [105052]
   Other proteins in same PDB: d1rq7a2, d1rq7b2
   complexed with gdp

Details for d1rq7a1

PDB Entry: 1rq7, 2.6 Å

PDB Description: mycobacterium tuberculosis ftsz in complex with gdp

PDB Compounds: (A:) cell division protein ftsz

SCOPe Domain Sequences for d1rq7a1:

Sequence, based on SEQRES records:

>d1rq7a1 c.32.1.1 (A:8-205) Cell-division protein FtsZ {Mycobacterium tuberculosis [TaxId: 1773]}
lavikvvgiggggvnavnrmieqglkgvefiaintdaqallmsdadvkldvgrdstrglg
agadpevgrkaaedakdeieellrgadmvfvtagegggtgtggapvvasiarklgaltvg
vvtrpfsfegkrrsnqaengiaalrescdtlivipndrllqmgdaavslmdafrsadevl
lngvqgitdlittpglin

Sequence, based on observed residues (ATOM records):

>d1rq7a1 c.32.1.1 (A:8-205) Cell-division protein FtsZ {Mycobacterium tuberculosis [TaxId: 1773]}
lavikvvgiggggvnavnrmieqglkgvefiaintdaqallmsdadvkldvgrdstgadp
evgrkaaedakdeieellrgadmvfvtagegggtgtggapvvasiarklgaltvgvvtrp
fsfegkrrsnqaengiaalrescdtlivipndrllqmgdaavslmdafrsadevllngvq
gitdlittpglin

Timeline for d1rq7a1:

• d1rq7a1 first appeared in SCOP 1.69
  
• d1rq7a1 appears in SCOPe 2.07