Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (1 family) |
Family d.79.2.1: Tubulin, C-terminal domain [55308] (3 proteins) |
Protein Cell-division protein FtsZ [55309] (3 species) |
Species Mycobacterium tuberculosis [TaxId:1773] [111032] (3 PDB entries) |
Domain d1rq2b2: 1rq2 B:206-312 [105051] Other proteins in same PDB: d1rq2a1, d1rq2b1 |
PDB Entry: 1rq2 (more details), 1.86 Å
SCOP Domain Sequences for d1rq2b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rq2b2 d.79.2.1 (B:206-312) Cell-division protein FtsZ {Mycobacterium tuberculosis} vdfadvkgimsgagtalmgigsargegrslkaaeiainsplleasmegaqgvlmsiaggs dlglfeineaaslvqdaahpdaniifgtviddslgdevrvtviaagf
Timeline for d1rq2b2: