SCOP 1.73: Domain d1rq2a2: 1rq2 A:206-312

Lineage for d1rq2a2 (1rq2 A:206-312)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (1 family)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (3 proteins)

6. Protein Cell-division protein FtsZ [55309] (4 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [111032] (3 PDB entries)

8. Domain d1rq2a2: 1rq2 A:206-312 [105049]
   Other proteins in same PDB: d1rq2a1, d1rq2b1

Details for d1rq2a2

PDB Entry: 1rq2, 1.86 Å

PDB Description: mycobacterium tuberculosis ftsz in complex with citrate

PDB Compounds: (A:) cell division protein ftsz

SCOP Domain Sequences for d1rq2a2:

Sequence; same for both SEQRES and ATOM records:

>d1rq2a2 d.79.2.1 (A:206-312) Cell-division protein FtsZ {Mycobacterium tuberculosis [TaxId: 1773]}
vdfadvkgimsgagtalmgigsargegrslkaaeiainsplleasmegaqgvlmsiaggs
dlglfeineaaslvqdaahpdaniifgtviddslgdevrvtviaagf

Timeline for d1rq2a2:

• d1rq2a2 first appeared in SCOP 1.69
  
• d1rq2a2 appears in SCOP 1.71
  
• d1rq2a2 appears in SCOP 1.75
  
• d1rq2a2 appears in the current release, SCOPe 2.08