Lineage for d1rq1a_ (1rq1 A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 546309Fold a.227: ERO1-like [110018] (1 superfamily)
    multihelical; consists of 2 four-helical bundles
  4. 546310Superfamily a.227.1: ERO1-like [110019] (1 family) (S)
    similar active site architecture to scop_sf 69000
  5. 546311Family a.227.1.1: ERO1-like [110020] (1 protein)
    Pfam 04137
  6. 546312Protein Endoplasmic oxidoreductin 1, Ero1p [110021] (1 species)
  7. 546313Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [110022] (2 PDB entries)
  8. 546315Domain d1rq1a_: 1rq1 A: [105047]
    complexed with cd, fad, nen

Details for d1rq1a_

PDB Entry: 1rq1 (more details), 2.8 Å

PDB Description: Structure of Ero1p, Source of Disulfide Bonds for Oxidative Protein Folding in the Cell

SCOP Domain Sequences for d1rq1a_:

Sequence, based on SEQRES records: (download)

>d1rq1a_ a.227.1.1 (A:) Endoplasmic oxidoreductin 1, Ero1p {Baker's yeast (Saccharomyces cerevisiae)}
gsfnelnainenirddlsallksdffkyfrldlykqcsfwdandglclnracsvdvvedw
dtlpeywqpeilgsfnndtmkeaddsddeckfldqlcqtskkpvdiedtinycdvndfng
knavlidltanperftgyggkqagqiwstiyqdncftigetgeslakdafyrlvsgfhas
igthlskeylntktgkwepnldlfmarignfpdrvtnmyfnyavvakalwkiqpylpefs
fcdlvnkeiknkmdnvisqldtkifnedlvfandlsltlkdefrsrfknvtkimdcvqcd
rcrlwgkiqttgyatalkilfeindadeftkqhivgkltkyeliallqtfgrlsesiesv
nmfekmygkrl

Sequence, based on observed residues (ATOM records): (download)

>d1rq1a_ a.227.1.1 (A:) Endoplasmic oxidoreductin 1, Ero1p {Baker's yeast (Saccharomyces cerevisiae)}
gsfnelnainenirddlsallksdffkyfrldlykqcsfwlclnracsvdvvedwdtlpe
ywqpeilgsfnndtmkeaddsddeckfldqlcqtskkycdvndfngknavlidltanper
ftgyggkqagqiwstiyqdncftigetgeslakdafyrlvsgfhasigthlskeylntkt
gkwepnldlfmarignfpdrvtnmyfnyavvakalwkiqpylpefsfcdlvnkeiknkmd
nvisqldtkifnedlvfandlsltlkdefrsrfnvtkimdcvqcdrcrlwgkiqttgyat
alkilfeindadeftkqhivgkltkyeliallqtfgrlsesiesvnmfekmygkrl

SCOP Domain Coordinates for d1rq1a_:

Click to download the PDB-style file with coordinates for d1rq1a_.
(The format of our PDB-style files is described here.)

Timeline for d1rq1a_: