Lineage for d1rq1a1 (1rq1 A:56-424)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2015699Fold a.227: ERO1-like [110018] (1 superfamily)
    multihelical; consists of 2 four-helical bundles
  4. 2015700Superfamily a.227.1: ERO1-like [110019] (1 family) (S)
    similar active site architecture to (69000)
    automatically mapped to Pfam PF04137
  5. 2015701Family a.227.1.1: ERO1-like [110020] (2 protein domains)
    Pfam PF04137
  6. 2015702Protein Endoplasmic oxidoreductin 1, Ero1p [110021] (1 species)
  7. 2015703Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [110022] (2 PDB entries)
    Uniprot Q03103 56-424
  8. 2015705Domain d1rq1a1: 1rq1 A:56-424 [105047]
    Other proteins in same PDB: d1rq1a2
    complexed with cd, fad, nen

Details for d1rq1a1

PDB Entry: 1rq1 (more details), 2.8 Å

PDB Description: Structure of Ero1p, Source of Disulfide Bonds for Oxidative Protein Folding in the Cell
PDB Compounds: (A:) Hypothetical 65.0 kDa protein in COX14-COS3 intergenic region precursor

SCOPe Domain Sequences for d1rq1a1:

Sequence, based on SEQRES records: (download)

>d1rq1a1 a.227.1.1 (A:56-424) Endoplasmic oxidoreductin 1, Ero1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
fnelnainenirddlsallksdffkyfrldlykqcsfwdandglclnracsvdvvedwdt
lpeywqpeilgsfnndtmkeaddsddeckfldqlcqtskkpvdiedtinycdvndfngkn
avlidltanperftgyggkqagqiwstiyqdncftigetgeslakdafyrlvsgfhasig
thlskeylntktgkwepnldlfmarignfpdrvtnmyfnyavvakalwkiqpylpefsfc
dlvnkeiknkmdnvisqldtkifnedlvfandlsltlkdefrsrfknvtkimdcvqcdrc
rlwgkiqttgyatalkilfeindadeftkqhivgkltkyeliallqtfgrlsesiesvnm
fekmygkrl

Sequence, based on observed residues (ATOM records): (download)

>d1rq1a1 a.227.1.1 (A:56-424) Endoplasmic oxidoreductin 1, Ero1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
fnelnainenirddlsallksdffkyfrldlykqcsfwlclnracsvdvvedwdtlpeyw
qpeilgsfnndtmkeaddsddeckfldqlcqtskkycdvndfngknavlidltanperft
gyggkqagqiwstiyqdncftigetgeslakdafyrlvsgfhasigthlskeylntktgk
wepnldlfmarignfpdrvtnmyfnyavvakalwkiqpylpefsfcdlvnkeiknkmdnv
isqldtkifnedlvfandlsltlkdefrsrfnvtkimdcvqcdrcrlwgkiqttgyatal
kilfeindadeftkqhivgkltkyeliallqtfgrlsesiesvnmfekmygkrl

SCOPe Domain Coordinates for d1rq1a1:

Click to download the PDB-style file with coordinates for d1rq1a1.
(The format of our PDB-style files is described here.)

Timeline for d1rq1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rq1a2