SCOPe 2.05: Domain d1rpwd1: 1rpw D:2-72

Lineage for d1rpwd1 (1rpw D:2-72)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)

6. Protein Multidrug binding protein QacR [68964] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [68965] (24 PDB entries)
   Uniprot P23217

8. Domain d1rpwd1: 1rpw D:2-72 [105042]
   Other proteins in same PDB: d1rpwa2, d1rpwb2, d1rpwc2, d1rpwd2
   complexed with did, so4

Details for d1rpwd1

PDB Entry: 1rpw, 2.9 Å

PDB Description: crystal structure of the multidrug binding protein qacr bound to the diamidine hexamidine

PDB Compounds: (D:) Transcriptional regulator qacR

SCOPe Domain Sequences for d1rpwd1:

Sequence; same for both SEQRES and ATOM records:

>d1rpwd1 a.4.1.9 (D:2-72) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]}
nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieeskw
qeqwkkeqika

Timeline for d1rpwd1:

• d1rpwd1 first appeared in SCOP 1.69
  
• d1rpwd1 appears in SCOPe 2.04
  
• d1rpwd1 appears in SCOPe 2.06
  
• d1rpwd1 appears in the current release, SCOPe 2.08