Lineage for d1rpwb2 (1rpw B:73-187)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 543325Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 543326Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (1 family) (S)
  5. 543327Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (9 proteins)
  6. 543353Protein Multidrug binding protein QacR [69107] (1 species)
  7. 543354Species Staphylococcus aureus [TaxId:1280] [69108] (11 PDB entries)
  8. 543380Domain d1rpwb2: 1rpw B:73-187 [105039]
    Other proteins in same PDB: d1rpwa1, d1rpwb1, d1rpwc1, d1rpwd1

Details for d1rpwb2

PDB Entry: 1rpw (more details), 2.9 Å

PDB Description: crystal structure of the multidrug binding protein qacr bound to the diamidine hexamidine

SCOP Domain Sequences for d1rpwb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rpwb2 a.121.1.1 (B:73-187) Multidrug binding protein QacR {Staphylococcus aureus}
ktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklenkyidayhvifk
egnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqiflngls

SCOP Domain Coordinates for d1rpwb2:

Click to download the PDB-style file with coordinates for d1rpwb2.
(The format of our PDB-style files is described here.)

Timeline for d1rpwb2: