Lineage for d1rpwa2 (1rpw A:73-187)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 447981Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 447982Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (1 family) (S)
  5. 447983Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (9 proteins)
  6. 448007Protein Multidrug binding protein QacR [69107] (1 species)
  7. 448008Species Staphylococcus aureus [TaxId:1280] [69108] (11 PDB entries)
  8. 448033Domain d1rpwa2: 1rpw A:73-187 [105037]
    Other proteins in same PDB: d1rpwa1, d1rpwb1, d1rpwc1, d1rpwd1

Details for d1rpwa2

PDB Entry: 1rpw (more details), 2.9 Å

PDB Description: Crystal Structure Of The Multidrug Binding Protein Qacr Bound To The Diamidine Hexamidine

SCOP Domain Sequences for d1rpwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rpwa2 a.121.1.1 (A:73-187) Multidrug binding protein QacR {Staphylococcus aureus}
ktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklenkyidayhvifk
egnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqiflngls

SCOP Domain Coordinates for d1rpwa2:

Click to download the PDB-style file with coordinates for d1rpwa2.
(The format of our PDB-style files is described here.)

Timeline for d1rpwa2: