![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.4: I set domains [49159] (34 proteins) |
![]() | Protein IgE high affinity receptor alpha subunit [49200] (1 species) possibly an intermediate structure between the I set and FnIII domains |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49201] (7 PDB entries) |
![]() | Domain d1rpqc2: 1rpq C:86-171 [105033] |
PDB Entry: 1rpq (more details), 3 Å
SCOP Domain Sequences for d1rpqc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rpqc2 b.1.1.4 (C:86-171) IgE high affinity receptor alpha subunit {Human (Homo sapiens)} dwlllqasaevvmegqplflrchgwrnwdvykviyykdgealkywyenhnisitnatved sgtyyctgkvwqldyeseplnitvik
Timeline for d1rpqc2: