Lineage for d1rpqc2 (1rpq C:86-171)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 454655Family b.1.1.4: I set domains [49159] (32 proteins)
  6. 454776Protein IgE high affinity receptor alpha subunit [49200] (1 species)
    possibly an intermediate structure between the I set and FnIII domains
  7. 454777Species Human (Homo sapiens) [TaxId:9606] [49201] (7 PDB entries)
  8. 454799Domain d1rpqc2: 1rpq C:86-171 [105033]

Details for d1rpqc2

PDB Entry: 1rpq (more details), 3 Å

PDB Description: high affinity ige receptor (alpha chain) complexed with tight-binding e131 'zeta' peptide from phage display

SCOP Domain Sequences for d1rpqc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rpqc2 b.1.1.4 (C:86-171) IgE high affinity receptor alpha subunit {Human (Homo sapiens)}
dwlllqasaevvmegqplflrchgwrnwdvykviyykdgealkywyenhnisitnatved
sgtyyctgkvwqldyeseplnitvik

SCOP Domain Coordinates for d1rpqc2:

Click to download the PDB-style file with coordinates for d1rpqc2.
(The format of our PDB-style files is described here.)

Timeline for d1rpqc2: