Lineage for d1rp4a_ (1rp4 A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 450764Fold a.227: ERO1-like (Pfam 04137) [110018] (1 superfamily)
    multihelical; consists of 2 four-helical bundles
  4. 450765Superfamily a.227.1: ERO1-like (Pfam 04137) [110019] (1 family) (S)
  5. 450766Family a.227.1.1: ERO1-like (Pfam 04137) [110020] (1 protein)
  6. 450767Protein Endoplasmic oxidoreductin 1, Ero1p [110021] (1 species)
  7. 450768Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [110022] (2 PDB entries)
  8. 450769Domain d1rp4a_: 1rp4 A: [105027]

Details for d1rp4a_

PDB Entry: 1rp4 (more details), 2.2 Å

PDB Description: structure of ero1p, source of disulfide bonds for oxidative protein folding in the cell

SCOP Domain Sequences for d1rp4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rp4a_ a.227.1.1 (A:) Endoplasmic oxidoreductin 1, Ero1p {Baker's yeast (Saccharomyces cerevisiae)}
gsfnelnainenirddlsallksdffkyfrldlykqcsfwdandglclnracsvdvvedw
dtlpeywqpeilgsfnndtmkeaddsddeckfldqlcqtskkpvdiedtinycdvndfng
knavlidltanperftgyggkqagqiwstiyqdncftigetgeslakdafyrlvsgfhas
igthlskeylntktgkwepnldlfmarignfpdrvtnmyfnyavvakalwkiqpylpefs
fcdlvnkeiknkmdnvisqldtkifnedlvfandlsltlkdefrsrfknvtkimdcvqcd
rcrlwgkiqttgyatalkilfeindadeftkqhivgkltkyeliallqtfgrlsesiesv
nmfekmygkrller

SCOP Domain Coordinates for d1rp4a_:

Click to download the PDB-style file with coordinates for d1rp4a_.
(The format of our PDB-style files is described here.)

Timeline for d1rp4a_: