Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.1: Cystatin/monellin [54403] (7 families) has a additional strand at the N-terminus |
Family d.17.1.2: Cystatins [54407] (7 proteins) automatically mapped to Pfam PF00031 |
Protein Cystatin D [110819] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [110820] (2 PDB entries) Uniprot P28325 31-142 |
Domain d1roaa_: 1roa A: [105024] |
PDB Entry: 1roa (more details), 1.8 Å
SCOPe Domain Sequences for d1roaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1roaa_ d.17.1.2 (A:) Cystatin D {Human (Homo sapiens) [TaxId: 9606]} ggihatdlndksvqraldfaiseynkvinkdeyysrplqvmaayqqivggvnyyfnvkfg rttctksqpnldncpfndqpklkeeefcsfqinevpwedkisilnykcrkv
Timeline for d1roaa_: