Lineage for d1rmka_ (1rmk A:)

  1. Root: SCOP 1.69
  2. 520835Class g: Small proteins [56992] (75 folds)
  3. 521093Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 521298Superfamily g.3.6: omega toxin-like [57059] (4 families) (S)
  5. 521299Family g.3.6.1: Conotoxin [57060] (1 protein)
  6. 521300Protein Conotoxin [57061] (13 species)
  7. 521319Species Marble cone (Conus marmoreus), mrVIb [TaxId:42752] [111394] (1 PDB entry)
  8. 521320Domain d1rmka_: 1rmk A: [105014]

Details for d1rmka_

PDB Entry: 1rmk (more details)

PDB Description: solution structure of conotoxin mrvib

SCOP Domain Sequences for d1rmka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rmka_ g.3.6.1 (A:) Conotoxin {Marble cone (Conus marmoreus), mrVIb}
acskkweycivpilgfvyccpglicgpfvcv

SCOP Domain Coordinates for d1rmka_:

Click to download the PDB-style file with coordinates for d1rmka_.
(The format of our PDB-style files is described here.)

Timeline for d1rmka_: