Lineage for d1rm9a_ (1rm9 A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 501707Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 501708Superfamily d.22.1: GFP-like [54511] (2 families) (S)
  5. 501709Family d.22.1.1: Fluorescent proteins [54512] (4 proteins)
  6. 501710Protein Green fluorescent protein, GFP [54513] (1 species)
  7. 501711Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (53 PDB entries)
  8. 501781Domain d1rm9a_: 1rm9 A: [105012]

Details for d1rm9a_

PDB Entry: 1rm9 (more details), 2.9 Å

PDB Description: Probing the Role of Tryptophans in Aequorea Victoria Green Fluorescent Proteins with an Expanded Genetic Code

SCOP Domain Sequences for d1rm9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rm9a_ d.22.1.1 (A:) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria)}
kgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlvt
tltwgvqcfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvnr
ielkgidfkedgnilghkleynyishnvyitadkqkngikanfkirhniedgsvqladhy
qqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagi

SCOP Domain Coordinates for d1rm9a_:

Click to download the PDB-style file with coordinates for d1rm9a_.
(The format of our PDB-style files is described here.)

Timeline for d1rm9a_: