Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) N-terminal domain is the classic Rossmann-fold |
Family d.81.1.1: GAPDH-like [55348] (6 proteins) has many additional secondary structures |
Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species) |
Species Spinach (Spinacia oleracea) [TaxId:3562] [69769] (8 PDB entries) Uniprot P19866 |
Domain d1rm5b2: 1rm5 B:149-312 [105009] Other proteins in same PDB: d1rm5a1, d1rm5b1, d1rm5o1 complexed with ndp, so4; mutant |
PDB Entry: 1rm5 (more details), 2.1 Å
SCOPe Domain Sequences for d1rm5b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rm5b2 d.81.1.1 (B:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} cttnclapfvkvldqkfgiikgtmttthsytgdqrlldaahrdlrraraaclnivptstg aakavalvlpnlkgklngialrvptpnvsvvdlvvqvskktfaeevnaafresadnelkg ilsvcdeplvsidfrctdvsstidssltmvmgddmvkviawyd
Timeline for d1rm5b2:
View in 3D Domains from other chains: (mouse over for more information) d1rm5a1, d1rm5a2, d1rm5o1, d1rm5o2 |