SCOP 1.73: Domain d1rm5a1: 1rm5 A:1-148,A:313-333

Lineage for d1rm5a1 (1rm5 A:1-148,A:313-333)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (18 species)

7. Species Spinach (Spinacia oleracea) [TaxId:3562] [69409] (8 PDB entries)

8. Domain d1rm5a1: 1rm5 A:1-148,A:313-333 [105006]
   Other proteins in same PDB: d1rm5a2, d1rm5b2, d1rm5o2

Details for d1rm5a1

PDB Entry: 1rm5, 2.1 Å

PDB Description: crystal structure of mutant s188a of photosynthetic glyceraldehyde-3- phosphate dehydrogenase a4 isoform, complexed with nadp

PDB Compounds: (A:) Glyceraldehyde 3-phosphate dehydrogenase A

SCOP Domain Sequences for d1rm5a1:

Sequence; same for both SEQRES and ATOM records:

>d1rm5a1 c.2.1.3 (A:1-148,A:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]}
lkvaingfgrigrnflrcwhgrkdspldvvvindtggvkqashllkydsilgtfdadvkt
agdsaisvdgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvli
tapgkgdiptyvvgvneegythadtiisnasXnewgysqrvvdladivankwq

Timeline for d1rm5a1:

• d1rm5a1 first appeared in SCOP 1.69
  
• d1rm5a1 appears in SCOP 1.71
  
• d1rm5a1 appears in SCOP 1.75
  
• d1rm5a1 appears in the current release, SCOPe 2.08