Lineage for d1rm4o2 (1rm4 O:149-312)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2203126Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2203127Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 2203128Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 2203219Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (20 species)
  7. 2203356Species Spinach (Spinacia oleracea) [TaxId:3562] [69769] (8 PDB entries)
    Uniprot P19866
  8. 2203359Domain d1rm4o2: 1rm4 O:149-312 [105005]
    Other proteins in same PDB: d1rm4a1, d1rm4b1, d1rm4o1
    complexed with ndp, so4

Details for d1rm4o2

PDB Entry: 1rm4 (more details), 2 Å

PDB Description: Crystal structure of recombinant photosynthetic glyceraldehyde-3-phosphate dehydrogenase A4 isoform, complexed with NADP
PDB Compounds: (O:) Glyceraldehyde 3-phosphate dehydrogenase A

SCOPe Domain Sequences for d1rm4o2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rm4o2 d.81.1.1 (O:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]}
cttnclapfvkvldqkfgiikgtmttthsytgdqrlldashrdlrraraaclnivptstg
aakavalvlpnlkgklngialrvptpnvsvvdlvvqvskktfaeevnaafresadnelkg
ilsvcdeplvsidfrctdvsstidssltmvmgddmvkviawyd

SCOPe Domain Coordinates for d1rm4o2:

Click to download the PDB-style file with coordinates for d1rm4o2.
(The format of our PDB-style files is described here.)

Timeline for d1rm4o2: