Lineage for d1rm4a2 (1rm4 A:149-312)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1033075Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 1033076Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 1033077Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 1033131Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species)
  7. 1033262Species Spinach (Spinacia oleracea) [TaxId:3562] [69769] (8 PDB entries)
    Uniprot P19866
  8. 1033263Domain d1rm4a2: 1rm4 A:149-312 [105001]
    Other proteins in same PDB: d1rm4a1, d1rm4b1, d1rm4o1
    complexed with ndp, so4

Details for d1rm4a2

PDB Entry: 1rm4 (more details), 2 Å

PDB Description: Crystal structure of recombinant photosynthetic glyceraldehyde-3-phosphate dehydrogenase A4 isoform, complexed with NADP
PDB Compounds: (A:) Glyceraldehyde 3-phosphate dehydrogenase A

SCOPe Domain Sequences for d1rm4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rm4a2 d.81.1.1 (A:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]}
cttnclapfvkvldqkfgiikgtmttthsytgdqrlldashrdlrraraaclnivptstg
aakavalvlpnlkgklngialrvptpnvsvvdlvvqvskktfaeevnaafresadnelkg
ilsvcdeplvsidfrctdvsstidssltmvmgddmvkviawyd

SCOPe Domain Coordinates for d1rm4a2:

Click to download the PDB-style file with coordinates for d1rm4a2.
(The format of our PDB-style files is described here.)

Timeline for d1rm4a2: