| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) ![]() N-terminal domain is the classic Rossmann-fold |
| Family d.81.1.1: GAPDH-like [55348] (6 proteins) has many additional secondary structures |
| Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (20 species) |
| Species Spinach (Spinacia oleracea) [TaxId:3562] [69769] (8 PDB entries) Uniprot P19866 |
| Domain d1rm3o2: 1rm3 O:149-312 [104999] Other proteins in same PDB: d1rm3a1, d1rm3b1, d1rm3o1 complexed with ndp, so4; mutant |
PDB Entry: 1rm3 (more details), 2.2 Å
SCOPe Domain Sequences for d1rm3o2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rm3o2 d.81.1.1 (O:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]}
cttnclapfvkvldqkfgiikgtmttthsytgdqrlldashrdlrraraaclnivptstg
aakavalvlpnlkgklngialrvptpnvsvvdlvvqvskktfaeevnaafresadnelkg
ilsvcdeplvsidfrctdvsstidssltmvmgddmvkviawyd
Timeline for d1rm3o2:
View in 3DDomains from other chains: (mouse over for more information) d1rm3a1, d1rm3a2, d1rm3b1, d1rm3b2 |