Lineage for d1rm3o2 (1rm3 O:149-312)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1659008Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 1659009Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 1659010Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 1659101Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species)
  7. 1659232Species Spinach (Spinacia oleracea) [TaxId:3562] [69769] (8 PDB entries)
    Uniprot P19866
  8. 1659241Domain d1rm3o2: 1rm3 O:149-312 [104999]
    Other proteins in same PDB: d1rm3a1, d1rm3b1, d1rm3o1
    complexed with ndp, so4; mutant

Details for d1rm3o2

PDB Entry: 1rm3 (more details), 2.2 Å

PDB Description: crystal structure of mutant t33a of photosynthetic glyceraldehyde-3- phosphate dehydrogenase a4 isoform, complexed with nadp
PDB Compounds: (O:) Glyceraldehyde 3-phosphate dehydrogenase A

SCOPe Domain Sequences for d1rm3o2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rm3o2 d.81.1.1 (O:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]}
cttnclapfvkvldqkfgiikgtmttthsytgdqrlldashrdlrraraaclnivptstg
aakavalvlpnlkgklngialrvptpnvsvvdlvvqvskktfaeevnaafresadnelkg
ilsvcdeplvsidfrctdvsstidssltmvmgddmvkviawyd

SCOPe Domain Coordinates for d1rm3o2:

Click to download the PDB-style file with coordinates for d1rm3o2.
(The format of our PDB-style files is described here.)

Timeline for d1rm3o2: